PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591827.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 265aa    MW: 30059.1 Da    PI: 7.6125
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591827.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.14.9e-18185219135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  XP_009591827.1 185 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 219
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.1E-792264IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.477179215IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-15179229IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-15180243No hitNo description
Gene3DG3DSA:3.30.50.109.6E-14183217IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.78E-13184231No hitNo description
PfamPF003207.1E-16185219IPR000679Zinc finger, GATA-type
PROSITE patternPS003440185210IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MDVYGAEVFR IDDLLDLSNE EMFSSSTGSS SNKTTNYVFD LNHQYHHPPH SDNINPAASY  60
YDPLIPNSAD FTDKLCVPSD DVAELEWLSN FVEDSSNNYP SNSLTGTINL NSNNTSFHSK  120
SRSKRSRATT ANTSWASSLQ QAHHKPTDEK PNQNPQYSNN HNTMKPKKES SRERSCEMSD  180
IPRKCTHCAS EKTPQWRTGP LGPKTLCNAC GVRYKSGRLV PEYRPAASPT FVLTQHSNSH  240
RKVMELRRQK EVQQQGMYEH HFQVC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591827.10.0PREDICTED: GATA transcription factor 4-like
RefseqXP_016439221.10.0PREDICTED: GATA transcription factor 4-like
SwissprotO497413e-69GATA2_ARATH; GATA transcription factor 2
TrEMBLM1AUN51e-110M1AUN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000307081e-110(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.15e-63GATA transcription factor 2